SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008256 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000008256
Domain Number - Region: 133-200
Classification Level Classification E-value
Superfamily EF-hand 0.00499
Family Calmodulin-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008256   Gene: ENSMGAG00000008075   Transcript: ENSMGAT00000009046
Sequence length 428
Comment pep:novel chromosome:UMD2:10:14689142:14694281:1 gene:ENSMGAG00000008075 transcript:ENSMGAT00000009046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRSVCPSTRGRYEGYSQVRFSYMRMKYLFISWLVVFIGSWVMYVQYSTYTELCRGHDCR
KIICDKYKTGVIDGSACSSLCAKETLYFGKCLSTKPSNQMYLGIWGNLQGVIKCQMEEAA
QLDFGTDPQPRKEIILFDKPTRGTTVEKFKEMVYGFFKAKLGEQGSLSELVNIILSFADG
NKDGRVSLPEAKSAWALLQLDEFLLMVMLQDKEHTPKLMGFCGNLYVIERVEYTSLYGIS
LPWIIELLIPSGFRRSMDQWFTPSWPRKAKIAIGLLEFVEDIFHGPYGNFLMCDTNARNL
GYNDKYDLKMMDMRKIVPEMNLKEMIKDRPCESDMDCVYGTDCRTLCDQSKMRCTTEVIQ
PNLAKVCQLLKDYLLRGAPSDIHEELEKQLYLCIALKVSANQVEMEHSLILNNLKTLLWK
KISHTTDS
Download sequence
Identical sequences G1N7Q1
ENSMGAP00000008256 ENSMGAP00000008256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]