SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008257 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008257
Domain Number 1 Region: 357-415
Classification Level Classification E-value
Superfamily EF-hand 0.00000000179
Family Eps15 homology domain (EH domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008257   Gene: ENSMGAG00000008060   Transcript: ENSMGAT00000009047
Sequence length 1357
Comment pep:novel chromosome:UMD2:21:8993842:9022830:-1 gene:ENSMGAG00000008060 transcript:ENSMGAT00000009047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFMFPVAGALGPPQGMIPMQQQGFPMVPVMQSNMPGMMGMNYGSQMPPGPMAMQGGMPLG
PMPAAGMPYMGQASFIGMRPAAPQYTPDMQKQFAEEQQKRFEHQQKFLEEERKRRQFEEQ
KQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSRDAKMHPTPASHPKKPDHPTSSSHSA
VSVSHSAFLDDEEFSDFIQGPTESPKAVPQPTSQPFQPFHSAAEAGQLLSEKAVVQPLPP
SSSLEEKVLDNGLNESEQEQTKLKASEVGRKASAAGQARPSLAINDWALVGGHESGTTAA
EVHKASEQNIAIEECGVGVFPSQDPIQQMMPPWIYNDSLVPELYKKILETTLTPAGIDTA
KLYPILMSSGLPRETLGQIWALANRTTPGKLTKEELYAVLAMIAVTQRGIPAVSPDMLNQ
FPAAPVPTLSGFPMPLPAAVSQQPLLPAGPPGSLPLSIGPPVMGLGISAAAPAGGAAAPP
AGAFAPSYPPSQVVKPEDDDFQEFQDASKSGSLDDSFTDFQGDGAGSSKAASSQHRSSVP
SLLMPLPGNKTLSSTDKYAVFKGIAAEKPESTATFGDSGDKYSAFRELEQPSESKYGGDN
LAEFKAAGTDDGFTDFKTADSISPLEPPTKDKTFPTSFPSLPAQSIQQTQAKTSFNLADL
DLFSSTGENKQLSFPPAFNASKPSSFPPPPSTTAQPAPSKSSSLADEFGEFNLFGEFSNS
ASASGQDDFADFMAFNNSSGFSEQKPDDKYSALKAETSPVPQPGSSASTGRSGQNSAAAA
TPTKYDIFKQLSLEGSGAGFEETKDSTLSSVKSDDDFADFHSNKFSSTCNSADKSLVDKV
AAFKQAKEDSASVKSLDLPSIGGSSVGKEDSEDALSVQFDMKLTDVEGDLKHVMSDSSLD
LPTVSGQHPPAADIDELKCAPFGSYNSGSAVSSLASYEWSDKDDIQQGKKFSFAQASGSG
SSAATSVLQKKETLFGSSENITMTTVSKVTTFSSEDALQDVSFAAFANFKDSRPISSGPS
DDDNGDFGEFARPSSEARDAAADPNQEADFLAGGISSEIQRESIDEFGEFQSEKPKISKF
DFLVATSQGKVKSSEEMIKSELATFDLSVQGSHKRSLSLGDREISRSSPLPALEQPFRDR
SNTLSEKPALPVIRDKYKDLTGEVEESERYAYEWQRCLESALQVIKKANDTLNGISSSSV
CTEVIQSAQGMEYLLGVVEVYRVTKRVELGIKATAVCSEKLQQLLKDIDKVWNNLISFMS
LAALTPDENSLDFSSCMLRPGIKNAQDLACGVCLLNVDSRSKKEEKPVEELPKKAFNSET
DNFKLAYGGHQYHASCANFWINCVEPKPPGLILPDLL
Download sequence
Identical sequences G1N7Q2
ENSMGAP00000008257 ENSMGAP00000008257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]