SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008628 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008628
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily EF-hand 1.29e-23
Family EF-hand modules in multidomain proteins 0.0058
Further Details:      
 
Domain Number 2 Region: 8-119
Classification Level Classification E-value
Superfamily EF-hand 6.35e-22
Family EF-hand modules in multidomain proteins 0.0026
Further Details:      
 
Domain Number 3 Region: 199-281
Classification Level Classification E-value
Superfamily RING/U-box 5.53e-20
Family ZZ domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008628   Gene: ENSMGAG00000008408   Transcript: ENSMGAT00000009428
Sequence length 653
Comment pep:novel chromosome:UMD2:7:12563051:12581888:1 gene:ENSMGAG00000008408 transcript:ENSMGAT00000009428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPDLQEAFNDIQSSVYRTALKLRSLQSLCQLDLINVSLVQHIVSSEQRQREKDISLKVQ
QLSGMLKELFERARLEKPGQVDPRAAEFTLSLLEAMYDRSGTGYIKTRSAAAALIALSGD
TLLAKYKAFFEFYAVPDGKKALITRSALRSLLTDLNQIPAVVGEGCTLSCVEIATHSCFH
GVLNSGIVEEKFLSWLRSGPALLQWLPTCYRLSATEMVSHRVRCRVCKTFPIIGLRYRCL
KCLNFDLCQVCFFTGRLSKPHKSSHPVVEYCVQMSAKANAKHFLCTVRNNLFQDCCRRKE
AQERKVLEIMEERHFPTHKKSRLLLVNNPIPESPKFISKNRTVLHKNDNNSKILKQAKNA
IITTHCKHQAIASFEADVLKMHDSIRSIHNKSRYTKKQLNKWKHKMQFLHNCLEDKSFKI
EAELLRLRASHGNLQMELCKMKQEIKTILQSTAHPSFSLCQTTMSRDQHVLQESKMQGGL
NPVQIKPISRTSSDWKALNHLNSANRIQVLESLEAPATVDFMFSEDPVKSVTLQSDRVFM
GQFRKIEDNQTYLPELMENYDGGIIRNTALTPAAIQIPSDKEEFCGEVNLQQLVMKLMDA
LSLQAQPDQQSTLKQHFFSTAECVCTSFSDLINQVTASLEVTENGIHLTAPLN
Download sequence
Identical sequences G1N8I7
ENSMGAP00000008628 ENSMGAP00000008628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]