SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008771 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008771
Domain Number 1 Region: 333-429
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 493-778
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 2.35e-19
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 3 Region: 66-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000402
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 175-251
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000332
Family Calmodulin-like 0.027
Further Details:      
 
Domain Number 5 Region: 257-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000057
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008771   Gene: ENSMGAG00000008517   Transcript: ENSMGAT00000009575
Sequence length 840
Comment pep:novel chromosome:UMD2:15:16090553:16270417:1 gene:ENSMGAG00000008517 transcript:ENSMGAT00000009575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKSRSFPLSLVLLGAFLSFTRGWMDLDGSRRPHSDLGRLHQEISGRFEVTRRKVLYGQD
GLHASCEKKYCGRGSRCVVNRDTNQPECRCIEDCKSSYMPICGSDGKFYENHCQLHRASC
LQRKKIYIIHSKDCFFKGDTCTMASYRRLKGVVLELQAQRSAPPRRPAADGAAQKRALVE
ELFQHLDANRDGHLSSSELAQVMKKEDLEDDLLDCTLEDLLRFDDYNNDGRLTLQELYTA
FQVVQLSLPEEQRVSITTITGGSATILTCSIRGALRPPIIWKRNGIILNFLDLEDINDFG
EDDSLYITKVTTIHMGNYTCHAYGYEELYQTHILQVNVPPVIRVYPETQAQEPGVSASLK
CHAEGIPNPRITWLKNGMDIVPKLSKQLTLLANGSELHISSVRYEDTGAYTCIAKNEVGV
DEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGITVLQPNECEIRRHIRPEER
IFSSYEEICPRVEGEGTQSCLWASAVNVRDKYIYVTQPKQNRVMVIDIQTQKAVQSVDVD
PLPTKLHYDKSHDQVWVLSWGDMRRSSPTLQVIAEASAGEEQHVIRTPFKGVDDFFIPPT
NLIINHVRFGFIYNKSKPAVRKIDLETVTHIKTISFRNHSCAPQTMAYTHLGGYFLVQCR
DQQGAAAPQLLIDSVTDAVIGTNGAVLGTPHISPDGRFLVSADGDGGRIQVQTVTVQGEI
KLIYDLQTNIHVSDLTFQPSFTEGNQYYIYATSHLQTDVLVVELSTGKMNVLKNLKDPIT
SKDWPWSSYNRIIKDSGLFGQYLITPAKESLFVINGRQNTLRCEVSGIRRGNTVVWVGEV
Download sequence
Identical sequences G1N8U1
ENSMGAP00000008771 ENSMGAP00000008771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]