SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008783 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008783
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000517
Family Polcalcin 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008783   Gene: ENSMGAG00000008559   Transcript: ENSMGAT00000009587
Sequence length 356
Comment pep:novel chromosome:UMD2:14:12222486:12234395:-1 gene:ENSMGAG00000008559 transcript:ENSMGAT00000009587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIPDFLTEEECKLIIHLAQLKGLQKSQILPTDDYEEAMEMIEISQMDFFNLLDHNQDGQL
QLKEVLTHTRLGNGRWMTPENIREMYTAVKADPDGNGVLSLEEFKRLNIRDFHKYIGSQK
VKTSDAVRNSQHTWLYQGEGAHQVMRAIRQRVMRLTRLPPEIVEHSEPLQVVRYDQGGHY
HAHMDSGPVFPETACSHTKLVANESAPFETSCRYVTVLFYLNNVTGGGETVFPIADNRTY
EEMSLIQNDVDLRDTRKNCDKGNLRVKPQQGTAVFWYNYLSDGEGWVGELDDFALHGGCL
VTQGTKWIANNWINVDPNRLRQQRFQQEMERYAGSGAGASGEWTVDKAYSGLHVEL
Download sequence
Identical sequences G1N8V2
ENSMGAP00000008783 ENSMGAP00000008783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]