SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009006 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009006
Domain Number 1 Region: 1372-1542,1591-1661,1727-1826
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.68e-118
Family Mammalian PLC 0.00000497
Further Details:      
 
Domain Number 2 Region: 303-339,501-719,747-777
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-38
Family Ras GEF 0.0051
Further Details:      
 
Domain Number 3 Region: 2113-2223
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-37
Family Ras-binding domain, RBD 0.00000264
Further Details:      
 
Domain Number 4 Region: 1987-2093
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-29
Family Ras-binding domain, RBD 0.0000191
Further Details:      
 
Domain Number 5 Region: 1852-1963
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-22
Family PLC-like (P variant) 0.0027
Further Details:      
 
Domain Number 6 Region: 1188-1220,1298-1361
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000224
Family EF-hand modules in multidomain proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009006   Gene: ENSMGAG00000008715   Transcript: ENSMGAT00000009818
Sequence length 2279
Comment pep:novel chromosome:UMD2:8:22306507:22427277:-1 gene:ENSMGAG00000008715 transcript:ENSMGAT00000009818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMTASVLVSVVQGKVIPAQSAGDENTENALDTSVIKRHTASPGRQTTRAVSYLHRL
EEESLQGSVPKIFTLTNKEMTDDNINESFWERNNAISDSVKFLNINCNIVQKNYKSNIPC
GQLYKSCGSLAGGEACLETGIPVSLERAMLAEIQLKMNGPSLRSQTAVNKSDGNDTDEVA
FFHFHCASERNISKALCKLHNGFILNDCLQPVSVDNGSTTGSPACTCTLVELTNNCENEN
GQHLYDDTLRDKYFCLERAPRKVKVCSGHSFFGNNFTGRMPSKPFLSHFEDCNDNCEEEM
EEDFFRNKKERSTLLIRRFCKNDKEVKKSVYTGTRAIVRTLPSGHIGTAAWNYVEQRKNN
SGLKWHCWSVVSSLGFLSINSRERALSEFSFCIIFSITWQGSEIRDTVSSALHLKLTVLM
SSTCHAKIGDDLCVKPCATGACSQYRATLQRTALSNYITGALLEATTSLGARSGLLNIFG
GSAGRTMLKERQACTSMAGSSVLPSNVAGISKELIDLQHLIQFPEEVASILTEQEQELYR
KVLPIDYLCFLTRDLGNAECQSKLPCIQASISATILSTPNGEHNAVEDLVTRFNEVSSWV
TWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLSRSRKVLKMWQFMDQSD
IETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEILDGASSLIRLC
PQYNSQDETLEFVSDYSGQDNFLQRVGQDGLNNPEKESTANSMFQTIRSCNRSLESEEGE
DNLSEESNSRKNSLKDRNRYQFIIGDLSDSESDIFEQLKDWDTSSTEEQQKAFCHGIELI
PWYVLSIRADVHQFMLQGATVIHYDQETHLSARCFLQLQPDNSTLTWTKPTTVCPANAKA
KLSVLGNAAELGKYQFLGSTGLNGLVEGFLDLFSAKAVYMGHSGIDMHTVCVQNKLCNMS
LEENGITLLYGLQTTDNKLLHFVAPKYTAKMLYDGLLELTKAVRKMRRFPDQRLQWLRKQ
YVSLYQEDGRFEGPTLAQAVELFGGRRWSTRNTSTGTLTKSTEKPSVQRNNTLGISAAKK
KKKVLMRGESGEATDDEMATRKAKSCKEYRNRSGSDPQDIDEQEESDQNIISNASPSNTL
SSRRAHSLTASGPPHLGAATSSPASTWSSSSWHGRVKGGMKGFQNFMVSDSNMTFVEFVE
LFKSFSVRSRKDLKDLFDVYAVPCNRSGLEPTPLYTNLKIDENSIGFQPDLDLLTRNVSD
LGLFIKSRQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGVGIQQLNDFLVNCQGEH
CTYDEILSIIQKFEPSVNMCQQGLLSFEGFARFLMDKDNFASKNDESQENAEDLQFPLSY
YYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKI
SFKEVVEAIDRNAFITSDMPIIISIENHCSLPQQRKMAEIFKNVFGDKLVTKFLFESDFS
DDPMLPSPGQLKRKILLKNKKLKAHQTPVDILKQKAHQLAHMQAQASNGASNPTPTNEEE
EDEEDEYDYDYESLSDDNILDDRPENKLSSDKLQFEYNEETAKRIKKADCATYSNKGKVY
DMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPSGSSRGKERKSRKSIF
GNNPGRLSPGESATLAKASGKGPFDVMRQTWEDPSSPFNSPASLSAIIRTPKCYHISSLN
ENAAKRLCRRYSQKLIQHTTCQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDL
PLQLNAAMFEANGGCGYVLKPPVLWDKNCSMYQQFCPLERDLDNKEPAIYSLTIVSGQNV
CPSNSTGSPCIEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVV
ENNSSAITAQRIIPLKALKRGYRHVQLHNLHNEALEISSLFINSRRMEESPSGNTVPASV
LFSSGERKASVPYKVTIHGIPGPEPFTVFNISGGTTAAQLLHQLLETTKSTESCAADYFL
MEEKSFLSKEKSECRKPPFQRVIGPEEGLVQLLNSWFPEEGYVGRIIFKTREENLNERNV
FQEAKEDAAITSEDDSFFVQVHDVSPEQPRTVIKAPRFSTAQDVIQQTLCKAKYSYSILS
NPNPSDYVLLEEVTKEPTNKKSSTSKPSQRILSDQECVFQAQSKWKGAGKFILKLKEQVQ
AARDDKRKGISFTSELKKLTKSSKQYRGFTSPPLQVLPDSPQNKDDRPTCSLTFSDVME
Download sequence
Identical sequences G1N9C9
ENSMGAP00000009006 ENSMGAP00000009006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]