SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009284 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009284
Domain Number 1 Region: 13-83
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000433
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009284   Gene: ENSMGAG00000009016   Transcript: ENSMGAT00000010103
Sequence length 389
Comment pep:novel chromosome:UMD2:5:15830778:15840851:-1 gene:ENSMGAG00000009016 transcript:ENSMGAT00000010103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASGASPSSQMSELEDVQVEMLEKARELFQLCDKDEKGFITKVDMQRLQSELPLTLEQLE
TVFDSLEQNNNGYLTPVEFSMGLGKLIGIDLCQEARRTDRSSHEETFESGWSDDMDPADD
EEKRFCSMMEQLGAAQVFEDPSEVRDLWARLRKERPELLANFEEFLLRVSSYIREVNHEK
ESMEQALKRKETDHDREVRCLYEEMEQQIKAERERLICQEALRHNRSNLLQKELRSKEQE
LEKILYRQKKLEHQLQSLNSEQLETRVQNERLRHLNESLLEELEKSKWELEAVKGQLQKL
QKEAQNEQEQKDRDVFRVSKNMQKEKQSLLRQLELLSREMNKKLRDERDTFEAKKPVSLR
KKILIPNHPPFICCCCCHHLGASHIHGGQ
Download sequence
Identical sequences G1N9Z1
ENSMGAP00000009284 ENSMGAP00000009284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]