SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009321 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009321
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000241
Family S100 proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009321   Gene: ENSMGAG00000009047   Transcript: ENSMGAT00000010140
Sequence length 144
Comment pep:novel chromosome:UMD2:14:14150031:14153079:1 gene:ENSMGAG00000009047 transcript:ENSMGAT00000010140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGCRASIPSTKHYSVNPAPTTKSPPATAGMPKRIPIAKQLASIKALEKGSDLEKAFATA
ALVYNNSADPEGKLSKAETKSLLQTQFSRFIQGQENKPKYQEIISALDEEPEKKIDFEDF
MISLVSLALLSDLLQEIKNVKSTK
Download sequence
Identical sequences G1NA18
ENSMGAP00000009321 ENSMGAP00000009321 XP_003210212.1.16129 XP_019475531.1.16129 XP_019475532.1.16129 XP_019475533.1.16129 XP_019475534.1.16129 XP_019475535.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]