SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010049 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010049
Domain Number 1 Region: 383-549
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-23
Family G proteins 0.0085
Further Details:      
 
Domain Number 2 Region: 136-236,278-336
Classification Level Classification E-value
Superfamily EF-hand 4.86e-21
Family Calbindin D9K 0.068
Further Details:      
 
Domain Number 3 Region: 16-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.99e-20
Family G proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010049   Gene: ENSMGAG00000009690   Transcript: ENSMGAT00000010895
Sequence length 586
Comment pep:novel chromosome:UMD2:16:13736446:13746362:1 gene:ENSMGAG00000009690 transcript:ENSMGAT00000010895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPRAEEITIPADVTPEKVPTHIVDYSETEQTEDELQEEIAKANVVCVVYDVTKEATIEK
IRTKWIPMVNGGAEKGARIPIILVGNKSDLQMGSSMEVILPIMNQFSEIETCVECSAKNL
KNISELFYYAQKAVLHPTAPLYDPEEKQLRPACSRALTRIFNLSDQDNNQILSDDELNYF
QKSCFGNPLAPQALEDVKMVVWKNTTDGVQDNGLTLNGFLFLNTLFIQRGRHETTWTILR
RFGYDDELELTDDYLYPQFRLPPGCSTELNHLGYQFLQRLFEKHDKDQDGALSPAELQNF
FSVFPCMPWGPELYNTVCTTDKGLLSLHGFLCQWTLVAYLDVQHCLECLGYLGYPILSEQ
DSQTQALTVTREKRIDLEKGQTQRNVFLCKVLGARGAGKSAFLQAFLGRSLAAQRENPGE
PSLYTINTVQVNGQEKYLILHEVSAEMQFTKASDAACDVACLIYDLSDPKSFNYCASIYK
QHYMDSQIPCVFVASKTDLPEASQQPGLSPAEFCYKHCLPPPFLFSCHSQGPPSTAVYTK
LATAATFPHLNAVELGAASFWLRVALGAAVTALVGFTLYRVLAKNK
Download sequence
Identical sequences G1NBM4
ENSMGAP00000010049 ENSMGAP00000010049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]