SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010056 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010056
Domain Number 1 Region: 327-602
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.57e-79
Family Mitochondrial carrier 0.0000519
Further Details:      
 
Domain Number 2 Region: 12-156
Classification Level Classification E-value
Superfamily EF-hand 1.09e-19
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 3 Region: 158-288
Classification Level Classification E-value
Superfamily EF-hand 0.0000000319
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010056   Gene: ENSMGAG00000009695   Transcript: ENSMGAT00000010902
Sequence length 675
Comment pep:novel chromosome:UMD2:6:24419966:24493667:-1 gene:ENSMGAG00000009695 transcript:ENSMGAT00000010902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACKVALTKRADPAELKTIFLKYASVEKNGEFFMSPNDFVTRYLKIIGDGLPNANTVQLL
AGVVDQTKDGLISFQEFVAFESVLCAPDALFIVAFQLFDKTGKGEVTFEDAKQVFGQTTI
HQHIPFNWNSEFVQLHFGKDRKRHLTYPEFTQFLLEIQLEHAKQAFVQRDNTQAGRVTAM
DFRDIMVTIRPHMLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLA
GNRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGTL
PYNLAEAQRQKAPGDVSRPVLIQIAESAYRFALGSIAGAVGATAVYPIDLVKTRMQNQRS
TGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMS
KDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALTVLRDLGFFG
LYKGAKACFLRDIPFSAIYFPCYAHLKASFANEDGRVSPGNLLLAGSIAGMPAASLVTPA
DVIKTRLQVAARAGQTTYSGVVDCFVKILREEGPKALWKGAGARVFRSSPQFGVTLVTYE
LLQRWFYVDFGGVKPVGSEPVPKSRITLPAPNPDHVGGYKLAVATFAGIENKFGLYLPRF
KPSPPTSKAAAAVGP
Download sequence
Identical sequences G1NBM9
ENSMGAP00000010056 ENSMGAP00000010056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]