SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010308 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010308
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily EF-hand 1.6e-25
Family S100 proteins 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010308   Gene: ENSMGAG00000009966   Transcript: ENSMGAT00000011159
Sequence length 93
Comment pep:novel chromosome:UMD2:1:155327262:155328960:-1 gene:ENSMGAG00000009966 transcript:ENSMGAT00000011159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQLEGAMETLINVFHHYSGKEGDKYKLSKKELKELLQSELGCFLETQKDTGAVEKIMQ
DLDENGDGEVDFQEYVVLVAALTVACNTNLNKR
Download sequence
Identical sequences G1NC70
ENSMGAP00000010308 ENSMGAP00000010308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]