SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010402 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010402
Domain Number 1 Region: 329-605
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.1e-75
Family Mitochondrial carrier 0.0000325
Further Details:      
 
Domain Number 2 Region: 13-158
Classification Level Classification E-value
Superfamily EF-hand 2.66e-22
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 3 Region: 129-256
Classification Level Classification E-value
Superfamily EF-hand 0.00000000377
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010402   Gene: ENSMGAG00000010053   Transcript: ENSMGAT00000011259
Sequence length 677
Comment pep:novel chromosome:UMD2:7:18564211:18614236:1 gene:ENSMGAG00000010053 transcript:ENSMGAT00000011259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PYFYLQVPSTKRADPAELRSIFLQYASVEKDGERYMTPEDFVQKYLGLYTDPRYNPKTVQ
LLAGVADQTKDGLISFQEFLAFESVLCTPDAIFVVAFQLFDKNGNGEVTFANVKEVFEQT
TIHHQIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQAEHARQAFALKDKNKSGMIT
GLDFSDVMVTLHSHMLTPFVEENLVSVAGGTVSRQVSFSYFNAFNALLNNMDLIRKIYSN
IAGTRKDVEVTKEEFTQSAIRFGQVTPLEIDILYQLTGLYSVTGRLTLADIERIAPLAEG
ALPYNLAELQRQQSFGELGRPIWLQIAESAYRFTLGSIAGAVGATAVYPIDLVKTRMQNQ
RSTGSVVGELMYKNSFDCFKKVLRFEGFFGLYRGLLPQLIGVAPEKAIKLTVNDFVRDKF
TKKDGSIPLPAEILAGGCAGASQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVMKDLGL
LGLYKGAKACFLRDIPFSAIYFPVYAHSKLMLADENGHVGGLNLLAAGAIAEGVPAASLV
TPADVIKTRLQVAARAGQTTYSGVIDCFGKILREEGPSAFWKGAAARVFRSSPQFGVTLV
TYELLQRWFYVDFGGIKPSGSEPIPKTRILDLPPVNPEHIGGYRLATATFAGIENKFGLY
LPKFRSSGTVSAQPKSS
Download sequence
Identical sequences G1NCE0
ENSMGAP00000010402 ENSMGAP00000010402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]