SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010575 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010575
Domain Number 1 Region: 11-185
Classification Level Classification E-value
Superfamily EF-hand 1.17e-22
Family Calmodulin-like 0.0038
Further Details:      
 
Domain Number 2 Region: 427-509,542-552
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.6e-18
Family Ferredoxin reductase FAD-binding domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 558-660,693-739
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000000000224
Family Reductases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010575   Gene: ENSMGAG00000010183   Transcript: ENSMGAT00000011435
Sequence length 739
Comment pep:novel chromosome:UMD2:12:19412635:19418422:1 gene:ENSMGAG00000010183 transcript:ENSMGAT00000011435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMSAAEDAAWLRWVTERFQSIAGQGEEIGVEEFKAALQVKESFFAERFFALFDVDGSGT
ISLGELHGALRLLLHGTAADKLRFLFQVYDVDVLPNQRAGEGAMASLWVGTAVPSGSGSI
DAAELLLVLQACLRESEISLPPQRLHDMARVLLEAADKDGNGSITFQELQQQLEAFPGLM
ENLTISRAGCPAVLLRAAQSCPFAQERAGVAAAFGGGMGTGMWCEGGEGLGLGLGLEMLA
SCAACYPPLAALPGGQRRSGACRASHPLPPSFPHTGSSGACGSCGPRVVFCTCFVFSISE
QTQAVLSYTATQTPLTAALLAGRLAQAGHGALSEFLLMARPEGGGLGGTAPQTGLALQVL
LFAMLAFSSPCVRRGGHFELFYWSHLSYIIIWALLFFHAPNFWKWFLVPGGLFVLEKAVG
MAVSRAMGLRIVEVHLLPSQVTHLVIQRPRSFHYEPGDYIYLNISAIAAYEWHPFSISSA
PEQQDTIWLHIRSLGQWTTRLYEFFRQPEPLQLHGSLERKRCWQWVQVSVELGENQQLCS
IKCYIDGPYGTPTRRIFTSEHAVLIGAGIGITPFASILQSIMYRYHQRKQNCPKRETLWD
EDMALRKVDFIWINRDQQHFEWFLDLLAALELQQEEQEPGGRFLELHLYMTSALGRSDVK
AVGLQLALDLLAAKEQKDSITGLRTRTQPGRPDWSQVLGRVAEERKGKVHVFFCGSPALA
KVVRVHCERFGFRFFKENF
Download sequence
Identical sequences G1NCS3
ENSMGAP00000010575 ENSMGAP00000010575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]