SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010757 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010757
Domain Number 1 Region: 61-142
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000127
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010757   Gene: ENSMGAG00000010368   Transcript: ENSMGAT00000011620
Sequence length 145
Comment pep:novel chromosome:UMD2:2:27228915:27232163:-1 gene:ENSMGAG00000010368 transcript:ENSMGAT00000011620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMAPVSFRSPLLFCLVAAWLGPVPAEEPAAESPSSHGRLDKNLVQDKDHIMEHLEGVIE
KPESEMSPQELQLHYFKMHDYDGNNLLDGLELATAISHVHKEEGGENTQAMKEEELISLI
DDVLRDDDKNNDGYIDYAEFAKSLE
Download sequence
Identical sequences G1ND62
ENSMGAP00000010757 ENSMGAP00000010757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]