SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010932 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010932
Domain Number 1 Region: 10-127
Classification Level Classification E-value
Superfamily EF-hand 1.48e-26
Family Calmodulin-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010932   Gene: ENSMGAG00000010525   Transcript: ENSMGAT00000011799
Sequence length 129
Comment pep:novel chromosome:UMD2:12:20556625:20558177:-1 gene:ENSMGAG00000010525 transcript:ENSMGAT00000011799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQANPFQHRICHVFSTSVDGDDSLSFEDFLDMLSAFSDAATSDIKSNYAFRIFDFNDDGV
LDRKDLEELVNCLTGQGEEARLSSAEMEQLICNVLEESDIDKDGTINLSEFQHVISRSPD
FVSSFKIVL
Download sequence
Identical sequences G1NDJ9
ENSMGAP00000010932 ENSMGAP00000010932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]