SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010973 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010973
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily EF-hand 1.27e-49
Family Calmodulin-like 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010973   Gene: ENSMGAG00000010564   Transcript: ENSMGAT00000011841
Sequence length 171
Comment pep:novel chromosome:UMD2:4:35579664:35584614:1 gene:ENSMGAG00000010564 transcript:ENSMGAT00000011841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNYRKPGFSTAQRKKSGLKPELTEEQKQEIREAFDLFDTDGSGSIDIKELKVAMRALG
FEPKKEEIKKMIADIDKEGSGTIDFEDFLAMMTQKMSEKDSKEEILKAFRLFDDDGTGKI
SFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Download sequence
Identical sequences G1NDN1
ENSMGAP00000010973 ENSMGAP00000010973 XP_003205733.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]