SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011308 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011308
Domain Number 1 Region: 12-359
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-138
Family Calpain large subunit, catalytic domain (domain II) 0.000000000109
Further Details:      
 
Domain Number 2 Region: 364-521
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.63e-60
Family Calpain large subunit, middle domain (domain III) 0.000000405
Further Details:      
 
Domain Number 3 Region: 532-708
Classification Level Classification E-value
Superfamily EF-hand 3.85e-46
Family Penta-EF-hand proteins 0.00000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011308   Gene: ENSMGAG00000010826   Transcript: ENSMGAT00000012180
Sequence length 710
Comment pep:known chromosome:UMD2:2:30729177:30738251:-1 gene:ENSMGAG00000010826 transcript:ENSMGAT00000012180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQYPAMMPFGGIAARLQRDRLRAEGVGEHNNAIKYLNQDYEALKQECIESGVLFRDPQFP
AGPTALGFKELGPYSSKTRGVEWKRPSELVDDPQFIVGGATRTDICQGALGDCWLLAAIG
SLTLNEELLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDLLPTKDGELLFVHSAE
CTEFWSALLEKAYAKLNGCYESLSGGSTTEGFEDFTGGVAEMYDLKRAPHNMGHIIRKAL
ERGSLLGCSIDITSAFDMEAVTFKKLVKGHAYSVTAFKDVNYRGQQEQLIRIRNPWGQVE
WTGAWSDGSSEWDNIDPSDREELQLKMEDGEFWMSFRDFMREFSRLEICNLTPDALTKDE
LSRWHTQVFEGTWRRGSTAGGCRNNPATFWINPQFKIKLLEEDDDPGDDEVACSFLVALM
QKHRRRERRVGGDMHTIGFAVYEVPEEAQGSQNVHLKKDFFLRNQSRARSETFINLREVS
NQIRLPPGEYIVVPSTFEPHKEADFILRVFTEKQSDTAELDEEISADLADEEEITEDDIE
DGFKSMFQQLAGEDMEISVFELKTILNRVIARHKDLKTDGFSLDSCRNMVNLMDKDGSAR
LGLVEFQILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMALESAGFKLNNKLHQVVVARYA
DAETGVDFDNFVCCLVKLETMFRFFHSMDPDGTGTAVMNLAEWLLLTMCG
Download sequence
Identical sequences G1NEF6
ENSMGAP00000011308 ENSMGAP00000011308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]