SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011383 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011383
Domain Number 1 Region: 322-631
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.58e-122
Family Mammalian PLC 0.00000023
Further Details:      
 
Domain Number 2 Region: 162-321
Classification Level Classification E-value
Superfamily EF-hand 9.06e-42
Family EF-hand modules in multidomain proteins 0.0067
Further Details:      
 
Domain Number 3 Region: 651-776
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-31
Family PLC-like (P variant) 0.00028
Further Details:      
 
Domain Number 4 Region: 33-146
Classification Level Classification E-value
Superfamily PH domain-like 5.52e-30
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011383   Gene: ENSMGAG00000010925   Transcript: ENSMGAT00000012258
Sequence length 913
Comment pep:novel chromosome:UMD2:6:35186005:35191836:1 gene:ENSMGAG00000010925 transcript:ENSMGAT00000012258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGILLLEKGQMCVKKTVSFSSMPTEKKISSASDCINAMVEGSELKKIRSNSRVYHRYFL
LDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGIYDQISEDCAFSIIYGE
NYESLDLVANSADIANVWVTGLRYLISYGKHTLDMIESTQDNMRTSWLSQMFSESDVDNL
GHIPLCNAVQFIKDLNPGLKTNKIELKFKELHRSKEKTGTEVTKEEFIEVFHELCTRPEI
YFLLVQFSSNKEFLDTKDLMMFLEAEQGMAHVTEEISLEIIQKYEPAKEGQEKGWLSIDG
FTNYLTSPDCHIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALK
MGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCS
IKQQKVMVQHMKKILGDKLHTQSPNIEDSYLPSPESLKGKILIKAKKLSSNCSGLEGDVT
DEDEGAEMSQRVGKEGVEQQNSLTGKRFQLCKELSELVSICKSVQFKEFQVSFQLQKYWE
VCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNF
QTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDTVPGVSPQLLHIKIISGQ
NFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTMHQNGDNPIFDESFEFQINLPEL
AMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEMLAHASLFVHVAITNRR
GGGKPHKRGLSVRKGKKSREYASLRTLWIKTIDEVFKNALQPIRDATDLRENMQNAVVSF
KELCGLSPVANLMQCILAVSTRLVGPDSAPLVVLNLNDQYPTMELQGIVPEVLKKIVTAY
DMLFYMLSEHFFL
Download sequence
Identical sequences G1NEL4
ENSMGAP00000011383 ENSMGAP00000011383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]