SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011677 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011677
Domain Number 1 Region: 11-192
Classification Level Classification E-value
Superfamily EF-hand 8.77e-35
Family Calmodulin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011677   Gene: ENSMGAG00000011182   Transcript: ENSMGAT00000012557
Sequence length 195
Comment pep:novel chromosome:UMD2:5:25267017:25282526:1 gene:ENSMGAG00000011182 transcript:ENSMGAT00000012557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAETHXLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDQNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDCAISFAEFVKVL
EKVDVEQKMSIRFLH
Download sequence
Identical sequences G1NFA6
ENSMGAP00000011677 ENSMGAP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]