SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011946 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011946
Domain Number 1 Region: 19-159
Classification Level Classification E-value
Superfamily EF-hand 6.27e-29
Family Calmodulin-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011946   Gene: ENSMGAG00000011423   Transcript: ENSMGAT00000012829
Sequence length 164
Comment pep:novel chromosome:UMD2:2:35245330:35254964:-1 gene:ENSMGAG00000011423 transcript:ENSMGAT00000012829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREEKEAHIADGVIAEIEKKITEAFEVFDRDGNENVDVREIGSIVRSLGCFPTEAELHEL
LAKVEEEEPTGYVHLEKFLPVMTKILLDRSYRPIPEDVLLHAFEALDEKKSGYITKEELV
KHMTEEGEPFTEEEMEEMLSSALDPETNAVHYRDYISMMIVDET
Download sequence
Identical sequences G1NFX6
ENSMGAP00000011946 ENSMGAP00000011946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]