SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012156 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012156
Domain Number 1 Region: 79-135,301-373
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000152
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 2 Region: 212-309
Classification Level Classification E-value
Superfamily EF-hand 0.0000722
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012156   Gene: ENSMGAG00000011606   Transcript: ENSMGAT00000013043
Sequence length 403
Comment pep:novel chromosome:UMD2:4:45642615:45674981:-1 gene:ENSMGAG00000011606 transcript:ENSMGAT00000013043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTENRSDLEDLHLYATPREQRFRRFASLEFEGQLYMTPYDFIQAVTNDEPKRTKKWRSLS
KQELNQILMETPPVWKGSSKLFRNLNEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDTD
GNEMVDKKEFLVLQEIFRKKNEKRERKGDEEKRTMLRIQLYGYHTPTNSVLKTEGEDLVP
RSYWDTLRRSTSQALFSDLAERTDDIASSLSDTTLLVHFFGKKGKAELNFEDFYRFMDNL
QTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSSYLENMRCRIPEEKGIPFEXFR
SFFQFLNNLEDFTIAMQMYNFASRSIGQDEFKRAVYVATGVKLSPHLVNTVFKIFDVDRD
DQLSYKEFIGIMKDRLNRGFRGYKPIQRYTTFKSCVRKELYSR
Download sequence
Identical sequences G1NGE7
ENSMGAP00000012156 ENSMGAP00000012156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]