SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012256 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012256
Domain Number 1 Region: 1881-1943
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000861
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012256   Gene: ENSMGAG00000011595   Transcript: ENSMGAT00000013145
Sequence length 2825
Comment pep:known chromosome:UMD2:2:37879675:37986908:-1 gene:ENSMGAG00000011595 transcript:ENSMGAT00000013145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRIS
RQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVR
YLAGCGLQSCPLLISKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRR
PECFGPALRGEGGNGLLAAMEEAIQISEDPTRDGPSPINGSSRTLEMEEQEDDTIHMGNA
IMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLEDLVGVISIPFHMPTIAK
DGTVVEPDMSAGFCPDHKAAMVLFLDRVYGIEDQEFLLHLLEVGFLPDLRAAASLDTAAL
SATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRD
SIEECLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGW
GNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVN
MMEKQSSMDSDGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMEKFANGWTYGETY
SESAKVQPLMKQYKLLSEKVRNLFPFNVKISHRHYIAFMTEYRILCYPKGQSIILCNNVR
MIVLGFSMKFLFIEVHSVSLNQVAMIMHVHNSLYLNILQKYRVSFFVKKQKNELLVLSVG
GGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYS
FLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLS
AASRPLSSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDART
VMKTGLESVKMALRAFLDNAAEDLEKTMENLKQGQFTHSRNQPKGVTQIINYTTVALLPV
LSSLFEHIGQHQFGEDLILEDVQVSCYRILSSLYALGTSKSIYVERQRSALGECLAAFSG
AFPVAFLETHLNKHNIYSIYNTKNARDRAVLNLPTSVEEVCPNIPSLVKLMEEIVELAES
GIRYTQMPHIMEVILPMLCSYMSHWWEHGPENNPDKAEVCCTALTSEHMNTLLGNILKII
YNNLGIDEGAWMKRLAVFSQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEG
RGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFI
YWSKSHNFKREEQNFVVQNEINNMSFLISDTKSKMSKAAVSDQERKKMKRKGDRYSMQTS
LIVAALKRLLPIGLNICAPGDQDLIALAKNRFSMKDTEDEVRDIIRSNLHLQGKLEDPAI
RWQMALYKDLPNRTEDSSDPEKTVERVLDIANVLFHLEQRSACVGRGYFFWVEHPQRSKK
AVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYDKSWIETEEHYFEDKLIEDL
AKPGEEPPEEDDSLKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEED
DDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIA
ILNGGNSTVQQKMLDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEG
SGEKVMQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQES
ISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWXRT
FGFYNLKKKQPPDLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLV
ESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGIISKRDFHKAMESHKHYTQSETE
FLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLELSES
VLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKE
KMELFVNFCEDTIFEMQLAAQISESDLNERSANKEDSEKDKPEEQDPGMGFFSLVTMKSA
LIALKYNLMTLMKMLSVKSLKKQMKKVKKMTMKDMVMALFSSYWSILMGLLHFACSVFRG
FFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGEGEEGERKPAETALPAEDLT
DLRTLSEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLLSTPSVAPMPEAQENVQRN
KMKEDEKEEKEETKSEPEKAEGENGEKEEKAKEDKAKQKLRQLHTHRYGEPEIQESAFWK
KIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSAVTEEKEIPVVSTGENM
KLDNLESDSQRVIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKR
EKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYG
RDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYL
AWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYT
VVAFNFFRKFYNKSEDGDMPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIY
RIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVP
HGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQY
EDQLN
Download sequence
Identical sequences G1NGN0
ENSMGAP00000012256 ENSMGAP00000012256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]