SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012335 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012335
Domain Number 1 Region: 139-205
Classification Level Classification E-value
Superfamily EF-hand 0.00000147
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012335   Gene: ENSMGAG00000011762   Transcript: ENSMGAT00000013225
Sequence length 365
Comment pep:novel chromosome:UMD2:10:28944507:28955041:1 gene:ENSMGAG00000011762 transcript:ENSMGAT00000013225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQEWQCAQSKGCFYLEEDGEIVSHKYRLQLPQRSTVCITIRPLPLRQIEGKSCHWLSVDT
VLYVLKENETTENLQLACFTDQQNKEEQMFGWKGELPSGVYWLLPFTTGCRLKKVKTPIT
GEAKLVYRDEDGELALTKEFRAALLDIFETIDLDGNGLLSLEEYNFFELRTSGETCDEEV
WAICKENFDMKKNELTRQGFMDLNLMEANDREGDPTDLWVTLLSLGYNKALEMTEACPFV
IDIYAEKCKPRIKAIYLEAGSWQLNRAICKSVVNKGDAKVMDGCENIIVYTYRTGMRITS
VIENKSDNKVIVHVNNEQSRNCLSNRGLAVFAVEVAPKSMMVSQHVMPLNEQEEWLYSCV
HSLLR
Download sequence
Identical sequences G1NGU1
ENSMGAP00000012335 ENSMGAP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]