SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012414 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012414
Domain Number 1 Region: 317-434
Classification Level Classification E-value
Superfamily EF-hand 1.08e-32
Family Osteonectin 0.0073
Further Details:      
 
Domain Number 2 Region: 226-296
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.31e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 88-163
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.71e-20
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 36-89
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000291
Family Ovomucoid domain III-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012414   Gene: ENSMGAG00000011816   Transcript: ENSMGAT00000013304
Sequence length 437
Comment pep:novel chromosome:UMD2:5:28645982:28724726:-1 gene:ENSMGAG00000011816 transcript:ENSMGAT00000013304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPFPCGLCLALHVLCFQSKVNFGRQHKLHSLQFLISDRDRDPQCNLHCSRSQSKPLCAS
DGRTYESMCDYQRAKCRESSLSVTHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFIPEC
NEDGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPSSQGNSGRKDDG
SKPTPTMETQPIFDGEEITAPTLWIKHLVIKDSKLNSSSIRNSEKVHSCDQERQSALEEA
RQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYETPVCESDARS
KSTEIDDPFKDRELPAGCPDGKKVEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSH
TLEERVVHWYFSQLDNNSSNDINKRELKPFKRYVKKKAKPKKCARRFTDYCDLNKDKSIS
LQELKGCLGVSKEGILI
Download sequence
Identical sequences G1NGZ7
ENSMGAP00000012414 ENSMGAP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]