SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012508 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012508
Domain Number 1 Region: 212-302
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 5.78e-18
Family Hypothetical protein YjcS 0.048
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily EF-hand 0.00000000176
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012508   Gene: ENSMGAG00000011916   Transcript: ENSMGAT00000013404
Sequence length 316
Comment pep:novel chromosome:UMD2:3:75296304:75338389:1 gene:ENSMGAG00000011916 transcript:ENSMGAT00000013404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDDGKLSFDEFKAYFADGVLSGEELHELFHTIDTHNTDNLDTEELCEYFSQHLGEYENVL
SVLEELNITILKAMDKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQASLECAMETTEEQ
TRQERQGPIKPEVLSVQWPGKRSARRLQRNNSLSPSNPQFNTVFMVSKGWIEEESQWMTQ
ISRLQKLIDRLEKKDLKLEPFEEEVLEENARSHIMIVQRQMSVIEEEIEEFRLALKQYVE
SASAQSGCLHVSIQKKLPNDSRFIIYEFWENSNIWNSHLQMNYSKTFQRSNVDFLETPEL
ITTMLVPASWWVLNNN
Download sequence
Identical sequences G1NH76
ENSMGAP00000012508 ENSMGAP00000012508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]