SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012525 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000012525
Domain Number - Region: 101-255
Classification Level Classification E-value
Superfamily EF-hand 0.000241
Family Calmodulin-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012525   Gene: ENSMGAG00000011938   Transcript: ENSMGAT00000013421
Sequence length 288
Comment pep:novel chromosome:UMD2:4:48945991:48970926:-1 gene:ENSMGAG00000011938 transcript:ENSMGAT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPLDFQLNSHLSTLANIHKIYHTLNRLNLTEDVGQDDRQTGSLRSCSSSDCFSKVMPPR
KKRRPAAGDDLSAKKSRHDGMYRKYDSTRIKAEEEVFSSKRCLEWFYEYAGTDDIVGPEG
MEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNSLDCLR
SLLNEPTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKTWSLFPVFHQFLEQSKY
KVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKGKQMT
Download sequence
Identical sequences G1NH89
ENSMGAP00000012525 ENSMGAP00000012525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]