SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012705 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012705
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily FKBP-like 9.23e-39
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily FKBP-like 1.36e-35
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 3 Region: 303-408
Classification Level Classification E-value
Superfamily FKBP-like 1.69e-30
Family FKBP immunophilin/proline isomerase 0.00061
Further Details:      
 
Domain Number 4 Region: 1-82
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-24
Family FKBP immunophilin/proline isomerase 0.00084
Further Details:      
 
Domain Number 5 Region: 412-489
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000588
Family Calmodulin-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012705   Gene: ENSMGAG00000012094   Transcript: ENSMGAT00000013602
Sequence length 502
Comment pep:novel chromosome:UMD2:6:49031602:49043563:-1 gene:ENSMGAG00000012094 transcript:ENSMGAT00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRGSTFNVFVGKGQLIAGMDKALVGMCVNERRFVKIPPKLAYGSEGVSGVIPPNAVLH
FDVLLIDLWNPEDEVQVETYFKPEKCTRRVQVSDFVRYHYNGTFLDGTLFDSSHNRMRTY
DTYVGIGWLIPGMDQGLLGMCIGEKRIITIPPFLAYGEEGDGSKEIPGQASLVFDVALLD
LHNPKDGITIENQLVPESCERRTQTGDFIRYHYNGTLLDGTLFDSSYSRNRTYDTYVGKG
YVIAGMDEGLLGVCTGERRRIIIPPHLGYGEEGRGKIPGSAVLVFDIHVADFHNPSDSVS
ITVNYKPSNCSLLSKKGDYLKYHYNASLLDGTLLVSTQSLGKTYNIVLGSGQVVIGMDMG
LQDMCVGERRTVVIPPHLGYGEDGVGTEGEVPGSAVLVFDIELLELVSGLPEGYMFVWNG
EVSPNLFEEIDQNHDGEVLLEEFSEYIQAQVDSGKGKLAPGFDFEKIVKNMFTNQDRDGN
GKVTVEEFKLKDQEAKEGHDEL
Download sequence
Identical sequences G1NHN2
ENSMGAP00000012705 ENSMGAP00000012705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]