SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012748 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012748
Domain Number 1 Region: 19-344
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.48e-129
Family Calpain large subunit, catalytic domain (domain II) 0.000000000143
Further Details:      
 
Domain Number 2 Region: 349-496
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 5.1e-51
Family Calpain large subunit, middle domain (domain III) 0.000003
Further Details:      
 
Domain Number 3 Region: 512-688
Classification Level Classification E-value
Superfamily EF-hand 1.67e-42
Family Penta-EF-hand proteins 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012748   Gene: ENSMGAG00000012108   Transcript: ENSMGAT00000013646
Sequence length 692
Comment pep:novel chromosome:UMD2:2:41439852:41466909:1 gene:ENSMGAG00000012108 transcript:ENSMGAT00000013646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLLHNSKPRPPPLPQEARATHSSGKGYQELKQECLRSGCLFEDPDFPANNASLFFSEK
PPIPFLWKRPGDIVKDPKFILGGATRTDICQGDLGDCWLLAAIASLTLNEKTLARVVPLE
QNFGPGYAGIFHFQFWQHNEWLDVVIDDRLPTFKDRLVFVHSAEHNEFWSALLEKAYAKL
NGSYEALKGGSTIEAMEDFTGGVGEMYEVKKAPGNFYEILEKALKRSSMVGCSIDTSSAA
ESEARTPFGLIKGHAYSVTGIDEVSYQGQKVQLIRIRNPWGQVEWNGPWSDNSLEWRLVS
PSEQKRLAQTVLDDGEFWMKFEDFTVHFDKVEICNLTPDALEDSTAHKWEVTIHEGSWVR
GSTAGGCRNFLVADTFWTNPQIKLHLTEKDDGQDDCTFIAALMQKDRRKLRKLGAEMLSI
GYSIYESPGGDEHLSKDFFRYHASKARSKTYINLREVSDRFKLPPGDYILVPTTFEPHQE
ADFCLRIFSEKKAITEDLDENVAIDLPEPPNPTPSPQETEEEKQFRALFEQISGKDMEVA
AEELEYVLNAVLKNTKDIKFKKLSLISCRNIISLMDTSGNGKLEFSEFKVFWEKLKKWIN
IFLRFDFDKSGSMSSYELRSALKAAGYQLNNYLLQLIVLRYSDEQFQIDFDDFLNCLIRL
ENASRVFQALSVKNKDFIKLNIGEFINLAMNI
Download sequence
Identical sequences G1NHS3
ENSMGAP00000012748 ENSMGAP00000012748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]