SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012873 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012873
Domain Number 1 Region: 14-100
Classification Level Classification E-value
Superfamily EF-hand 8.99e-28
Family Osteonectin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012873   Gene: ENSMGAG00000012249   Transcript: ENSMGAT00000013772
Sequence length 123
Comment pep:novel chromosome:UMD2:2:42612326:42614366:-1 gene:ENSMGAG00000012249 transcript:ENSMGAT00000013772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHAVSDPSLSSSRVSEPDPNHTLEERVVHWYFKQLDKNSSGDIGKKEIKPFKRFLRKKS
KPKKCVKKFVEYCDVNNDKSLSVQELMGCLGVTKEEGKAETKKRHTPKTNTESTSSNQQR
KQS
Download sequence
Identical sequences G1NI20
ENSMGAP00000012873 ENSMGAP00000012873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]