SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013059 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013059
Domain Number 1 Region: 77-159
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000293
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000013059
Domain Number - Region: 19-79
Classification Level Classification E-value
Superfamily EF-hand 0.0167
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013059   Gene: ENSMGAG00000012398   Transcript: ENSMGAT00000013961
Sequence length 675
Comment pep:novel chromosome:UMD2:4:56303205:56329385:-1 gene:ENSMGAG00000012398 transcript:ENSMGAT00000013961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLDPCSSLSPPCFTEEDRFSLEALRMIHKQMDDDKDGGIEVDESDEFLREDMQYKDASNK
HSHLHREDKHITIEDLWRRWKTSEVHNWTQEDTLQWLSEFVELPQYEKNFRESNVNGTTL
PRIAVNEHAFMISHLKIIDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFVLTVSIVIGF
GGCWFAYTQNRTSKEHITKMMKDLESLQTAEQSLLDLQERLEKAQEENRNVAVEKQNLER
KMMDEINDAKREAHRLRELREGAECELSRLKYAEEELVQVRMALKKAEKEFELRSNWSVP
EALQKWLQLTHEVEVQYYNIKRQHAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDE
VDHKILEAKKALSELTTCLRERLYRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMP
RVSIPPYPIAGGVDDLDEDTPPIVSQFHGSIVKPPSTLARSSSLCRSRRNVVPSSPQSQH
ALHSPDPDILSVSSCPALYRTEEEEEAIYFSADKQWEVQETGSECDSLNLSIGRKQSPPS
SLEMYQTLSPQKVSREELSLEESSTGDSSSLTADISRGSPDCVGMAETKSMIFSPASKVY
NGILEKSCSMNQLSSGIPVVKPRHTSCSSASSDSKPSQEACSVPRISSIPQDLYQNGEKN
KKPSKIKSLFKKKCK
Download sequence
Identical sequences G1NIG6
ENSMGAP00000013059 ENSMGAP00000013059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]