SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013157 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013157
Domain Number 1 Region: 243-398
Classification Level Classification E-value
Superfamily EF-hand 6.14e-21
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 2 Region: 74-225
Classification Level Classification E-value
Superfamily EF-hand 0.00000496
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013157   Gene: ENSMGAG00000012492   Transcript: ENSMGAT00000014059
Sequence length 433
Comment pep:novel chromosome:UMD2:5:37367503:37378862:-1 gene:ENSMGAG00000012492 transcript:ENSMGAT00000014059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKSEQELKDEEMELFTKYYMEWKGGRANVNTSYANIPRFYYRLPAEDEVLLQKLREESRA
VFLQRKSRELLDNEELQNLWFLLDKHQTSPMIGEEAMINYENFLKVGEKAGLKCKQFFTA
KIFAKLLHNDPYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILEL
IPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEEL
SKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSRYGTGTLTNIFLDRVFQECLT
YDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGYLNVFSLNYFFRAIQEQMKIH
GQEPVSFQDVKDEIFDMVKPKDPYRISLQDLINSSQGDTVTSILIDLNGFWTYENREVLV
ASDNDSVADADDT
Download sequence
Identical sequences G1NIP9
ENSMGAP00000013157 ENSMGAP00000013157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]