SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013520 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013520
Domain Number 1 Region: 70-356
Classification Level Classification E-value
Superfamily RNI-like 4.82e-64
Family 28-residue LRR 0.0049
Further Details:      
 
Domain Number 2 Region: 384-453
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000955
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013520   Gene: ENSMGAG00000012822   Transcript: ENSMGAT00000014428
Sequence length 460
Comment pep:novel chromosome:UMD2:5:40476508:40507242:1 gene:ENSMGAG00000012822 transcript:ENSMGAT00000014428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDVSLSPYQNEEKSDISKPPESPLSDASAEKATQGSDTDLDVEDPGKAFAGVMGVDLYLE
ACRLMEVVPVSHFAQNLAKPYINLNHHGLGPKGVKAIAITLVSNATVTHLELEDNHILAE
GAICIAEMLRENCSLRELNISNNHLDTEGAEAIASLLLENASYLHTLQLSGNSFGEEAAS
CLADALMSNYQVKKLDLSHNEFSEKGGQLLGQMLAVNTTLEILDLSWNHLRRKGTVAFGT
GLKGNAALKILNLSWNSIGNEGAQALAEALKVNNVLIHLDISNNQINNEGAKKICKGLRV
NGTLKVLKMANNLLTVEGATELVGSVRKNPNSMMEEINISNVLVNETFIKLLELVYQTRP
ELDVIYGEVEGCISKISNRHPNPMKVIQKYLNEHNLRLWDFFRKIDKDGNMKIPVSDFRR
AMMQQSNIQLDRVQIVELVRKLDQNQTGIVDYSFIHTHKP
Download sequence
Identical sequences G1NJK0
ENSMGAP00000013520 ENSMGAP00000013520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]