SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013577 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013577
Domain Number 1 Region: 57-184,215-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.12e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.052
Further Details:      
 
Domain Number 2 Region: 625-717
Classification Level Classification E-value
Superfamily EF-hand 6.77e-17
Family Calmodulin-like 0.0079
Further Details:      
 
Domain Number 3 Region: 313-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000165
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013577   Gene: ENSMGAG00000012868   Transcript: ENSMGAT00000014488
Sequence length 730
Comment pep:novel chromosome:UMD2:7:38111890:38163556:1 gene:ENSMGAG00000012868 transcript:ENSMGAT00000014488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTVLIGGGAIATVFGLSQFSQYRNKHGTLVNVQAAEAVTVPIKNDFPTREEQ
ISTLKSTPEFDVLIIGGGATGCGCALDAVTRGNTGLKTALLERDDFSSGTSSRSTKLIHG
GVRYLQKAIMKLDFEQYKMVKEALQERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWIGI
KLYDLVAGSQCLKRSYVLSKSRALEHFPMLRKDKLVGAIVYYDGQHNDARMNLAIALTAA
RYGAATANYTEVLRLLKRTEPGSGKQRVCGARCRDVLTGQEFDVKAKCVINATGPFTDSV
RKMDDQEVPNICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDS
PTDVTSHPIPTEEDINFILSEVRNYLSVDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSIC
RNHVVAVSDSGLVTIAGGKWTTYRAMAQDTIDAAIQAHNLPAGSSKTIGLLLQGAEDWSP
TLYIRLVQDYGLESEVAQHLASTYGDKAFEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEV
IYGVKEYARTAVDIVSRRTRLAFLNVQAAEEALPRIVDIMGKELNWNEQKKKEELEAARK
FLYYEMGYKVKSDQLTDSSEITLVPSDIERYKKRFHMFDKDKKGFITILDVQRVLESINV
QIDEKTLHDILHEVDLNKNGQVELIEFLQLMSAIQKGYVSGSRLAVLMKTAEENLRQRLV
IPVDRSGGGL
Download sequence
Identical sequences G1NJP3
ENSMGAP00000013577 ENSMGAP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]