SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013677 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013677
Domain Number 1 Region: 246-341
Classification Level Classification E-value
Superfamily EF-hand 5.62e-29
Family Eps15 homology domain (EH domain) 0.00000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013677   Gene: ENSMGAG00000012965   Transcript: ENSMGAT00000014589
Sequence length 766
Comment pep:novel chromosome:UMD2:2:55863740:55910277:1 gene:ENSMGAG00000012965 transcript:ENSMGAT00000014589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INSKVMEIFRQKSNCVLLQIMELCGATRLGYFGRSQFYIALKLVAVAQSGLPLRVESLNT
EKRISPLPRFVVSKNEQESRHTALYSSDADNPASYSGVIPPPPGRIQVKKGSVSHDAVQQ
RTSSDQQESTSPVVSPQQSPPTSPHTWRKHNRHPSGGNNERPLAGPGPFWAPFSEAQPGS
STSSDPIWSGHSPPPHQENWVSFADTPPTSALLAMHPASVQDQTTVRTVASATTTNEIRR
QSSSYDDPWKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELS
DFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLMPKLIDLEDSTEVGEQTGEVGYS
SSPAEAPPSKSPSMPSLNQTWPELNQSSEQWETFSERSSSSQTLTQFDSNIAPADPDTAI
VHPVPIRMTPSKIHMQEMELKRTGSDHTNPTSPLLVKPSDLPEENKMSSSVKYTSGNTVT
DGYSSSDSYTSDPEQIGSAVTRQRSHSGTSPDNTAPPPPPPRPHPSHSRSSSLDMNRSFS
VTPGQQQAGVVAYPPAVPPRPQPSQGAGPHVHRPVDADGLISHSSTSPQQIPEQPNFADF
SQFEAFAASGVNKEEDDEIETHSEALQVEKPSDSASSLRVAKADGRVDEKVPANVPSSAG
KGTTPLAPPPKPIRRRLKSEDELRPEAEEHTQKTGVIAAVLASQPSIPRSIGKDKKAIQA
SIRRNKETNTVLARLNSELQQQLKDVLEERISLEVQLEQLRPFSHL
Download sequence
Identical sequences G1NJX5
ENSMGAP00000013677 ENSMGAP00000013677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]