SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013745 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013745
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily EF-hand 1.15e-25
Family Calmodulin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013745   Gene: ENSMGAG00000013031   Transcript: ENSMGAT00000014660
Sequence length 145
Comment pep:novel chromosome:UMD2:5:45694327:45755410:-1 gene:ENSMGAG00000013031 transcript:ENSMGAT00000014660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFEVCDEGNKGYLNREDFEVAVVMLFGYNLSEVEVDSIMSSVRPENSGILFEKFLNLMS
AKKFAQLFSDETREIFTAFDVQDRGFLTFEDFKKTFNSVLPKLSERIIIEAFREVDRDSD
GRISFKEFECAMKHGQDEVSPLYFA
Download sequence
Identical sequences G1NK32
ENSMGAP00000013745 ENSMGAP00000013745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]