SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013774 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013774
Domain Number 1 Region: 630-707
Classification Level Classification E-value
Superfamily EF-hand 0.000000706
Family Calmodulin-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013774   Gene: ENSMGAG00000013057   Transcript: ENSMGAT00000014689
Sequence length 732
Comment pep:novel chromosome:UMD2:4:67037895:67058395:1 gene:ENSMGAG00000013057 transcript:ENSMGAT00000014689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGNLGDRACLSCSSLRLANKMTVHFKYCTGVAPVYTYSKKDHYCCWTKASERTYFTLMSS
SGSWMPLAAMGVLGPKYLPVRWWHSSRSLQDDSIVEKSLKSLKDKNKKLEEGGPVYSPTE
VEVVKKSIGQRIVDELKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICAD
LFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKQLRVKLELAKFLQ
DTIEEMALKNKAAKGNVTKDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQ
LVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKMIAEEGVDTLTVKELQAACRARGMR
ALGVTEERLKEQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVA
KEAQVKVAEVEGEKVDNKARLEATLQEEEAIRKENEEKEMERISEAAEKAKETLQVAAVK
EVESAVDLEPAVLQVKESQVAMGSKQELAKADMETLKDTAPILEGIKGEEITKEEIDMLS
DACSKLQEQKKSLTKEKEELEELKGDIQEYNEDLQEIKELSKAGQEEVVEESKASKRLTK
RVNRMIGQIDKIINELETNQRTVDVKLDRGDSPPAAGENLISIAELINAMKQIQKIPEEK
LTRIAEALDENKDGKIDIDNVVKVVELIDKEDVDIGTSQVAEIMALLQKEEKLEEKEKAK
EKHDKEAAEVKN
Download sequence
Identical sequences G1NK56
ENSMGAP00000013774 ENSMGAP00000013774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]