SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013797 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013797
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 7.92e-24
Family S100 proteins 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013797   Gene: ENSMGAG00000013077   Transcript: ENSMGAT00000014713
Sequence length 97
Comment pep:novel chromosome:UMD2:2:57236092:57236639:-1 gene:ENSMGAG00000013077 transcript:ENSMGAT00000014713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLENQRDPMALDKIMKDLD
QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK
Download sequence
Identical sequences A0A226MES4 G1NK73 P27003 R4GHU2
NP_990837.1.86415 XP_003204247.1.16129 XP_015135488.1.86415 XP_015740189.1.68032 ENSMGAP00000013797 ENSMGAP00000013797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]