SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014359 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014359
Domain Number 1 Region: 163-297,353-513
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.03e-58
Family Mammalian PLC 0.0000172
Further Details:      
 
Domain Number 2 Region: 12-162
Classification Level Classification E-value
Superfamily EF-hand 9.52e-36
Family EF-hand modules in multidomain proteins 0.0034
Further Details:      
 
Domain Number 3 Region: 532-655
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-27
Family PLC-like (P variant) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014359   Gene: ENSMGAG00000013582   Transcript: ENSMGAT00000015290
Sequence length 656
Comment pep:novel chromosome:UMD2:1:65805099:65845949:-1 gene:ENSMGAG00000013582 transcript:ENSMGAT00000015290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLFLNLVSCTWFLNIIQDDFMNGKIDLDSTIKLLEKLHMPFNLAHVKHVFKKTVDKRKI
HTINMEDFRAIYRAIVHRNEFHEIFCAYSQNRKYLADTELTEFLKKEQFKTEDAETTALE
VILKYEPIDEVRKRRQLSFEGFIRYMSSEDCTVFKKEHRTVYQDMNHPLCDYFISSSHNT
YLVSDQLIGPSDLNGYISALLKGCRCLEIDCWDGSNNDPVVYHGHTLTSKLTFCSVIHAV
DKYAFAVGIYTLVKMLQCFNKACKYTVILRFSEVTFGVTMVSDFIPRLKEVFSKPGYKFG
VSFHLMAKTHSGGKISPAIKAVTLNKRNMEISFCQHFVDSNHENNVFSLNPELQTTNRTK
ARLKQESEAGCILCSVRKHKASKLRKYFQKISISYMVVYQKCFRYFSHENLTKYFQFTKR
FSKAVTRGLKIKSPLAALNFVNSCRGMNFREYCAKSFTHLSESGFKFQHKFDCNCQRVAL
NFQTPGIPMELQNGKFLDNGGCGYILKPEFLRNRNSTFNPHNVGRYSKPISLSIRLISGH
QLPPSNLSKSNKADPLVQIEIYGVPEDQAKRKSSVIKSNALSPRWDETFSFTVQVPELAL
IRFCVQDEISLVANDFLGQYTLPLLSLSKGYCTVPLFSKRGGKLEPASLFVYVWYY
Download sequence
Identical sequences G1NLG3
ENSMGAP00000014359 ENSMGAP00000014359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]