SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014541 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014541
Domain Number 1 Region: 7-84,180-249
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000431
Family Calmodulin-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014541   Gene: ENSMGAG00000013755   Transcript: ENSMGAT00000015477
Sequence length 1996
Comment pep:novel chromosome:UMD2:5:60756786:60801246:-1 gene:ENSMGAG00000013755 transcript:ENSMGAT00000015477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEAEQDQYEARLKELFDSFDSTGTGSLGQEELTDLCHVLHLEEVAPALQQTLLQGNLLG
RVHFDQFKEALILILSRTLSNEEHFQEPGASDCHEDVSAQEAEMGALLGRCSCTDFFSSA
GERETVTFWEPLEQLGLNSALSPGCVQMGNEKRQKLIEAQGQLRFWNPDDLNASQGTSLP
TPEWVEEKLQEVCEHLGITRDGHLNRKKLISICEQFGLQHIDGEVLEEVLHNLEQDGTMS
VEDFFYSLFRNAKPLTPSASTPYRQLKRHLSMQSFDESGRRTAGPAAMPSTIGFCLFSGL
DDGMGYGCVEGILDCWHQEGVENSQDVLKALDFSLDGKVNLTELTLALENELLITKNSIH
QAALASFKTEIRHLLERVDQVAREKEKLRSDLEKAEKLKSLMASEVDDHHAAIERRNEYN
LRKLDEEYKERIGALKNELRKEREQILQQANRQRLELEQEIEKLKTDENYIRDRLTLSLK
ENSRLESELVETGEKLAEYESLASKLQRNLENVLAEKFGDLDPSSAEFFLQEERLAQMKN
EYELQCRELQDQIDELHSELEEYRTQGKVFRPSLKNSLLEEFDIDIKSYGNSGVEPDQGL
GSEDCNPLNMSIEAEMAIEQMKEQHHRDLHHLKQELEDTVNHYEKQLDETKTHYEKEQED
MRKKYSEEMRVMEKQIAGLRSQVAELQGEAAALREQQEKLGCEHNAEKNKLQVSFSEEKA
NLQELLRQEHEDDVRARLEQANEKFSREREELIQNGVWAEEKMRALLQALQDKLERMAEA
HALEKEGLLRKHRQELEEERQKMESDYNRRASHAESQFSADTQTLVNKYEETIQSLEGRY
QRELREFVELQREEKAQWEFERDEIAQEVAEAHEQLKERLANEKAASVALSQEKELLEKK
FKEEVNALVCEKEQLQKELQELRDAAEEQERKLSSEMLQLQNDHEKELKDKQELISTVEE
SGKLVSQKLERLNSEYKREKEELNSKLLALESLNKDICVKAEAEKAEMNLEISNLQEKVQ
KLQWENLSFSALQNHYRVLENEYTKAKSKIASFSATEPLGDDADVLINLQKVHEQAVKEN
VRMAAEIVRLQQRLQDAECRSMGHAQPDCSDQTLQLLDEVDPLFGGLPCDCRDEGKGTDL
DGFQLLEADAADLKEGMGSGLEGPCDGNGVDSGAPEVWVCHVPGGRMALESDGNLDFDKD
QEAVSQVPLLQRNRDLERVPRLKILQNGIKQQNVCLSNRAAPKSNSFHPDASKLQTELKH
VKELERAPGSMNGDLESAIPQLWQRVEELQERLMAQAKLLSLQEEIQAENEGLKSEVMKL
VEKNRVLEDNLCELRSFHCKLEESDLESMKLWEENTQLPKTVRELKDGQTLSVGGEIDVS
REKLRLRCQLGKPEERAAVLKALQDEHAQCGSTMKETSTEKRGLQEHNEMLEEVPTLVNP
NAMHFQEEERNAVMHGLQSTCTELQQKVDLLRCEAEKLREENAILKNKVMLLNEEGSASS
LKLRELNGSREEMRQKIEAVRKEKMAVQKMVDNLKKQVADLKVRNQQLDSENTELNQRNS
KNQADVQDLNQQLARVLKQKEREAGKCTLEEWEKERLALKEELENNKVKSSNVVSSLETE
LSKMKVQAHVLEQENRLLKEELEKAKQLPRCPDISDLQNEVSSLMTKNEKLLKEKEALSE
ELSRCVDKVAKVSFLESAVGSLKQEQKSWEQQSQTLKTQLSVSQEKVQSLDETLQNTSLQ
MSCLRSDLRVAQQEKEALEQEVMSLHKQLQNANEKNRVLARAVPSPGCTQQDELEQLMAQ
EQQLLRQEKERLQREARSSATELMHAREKIRQLESTVLSLKHQKHQSQSGIVKAIEQEKL
SLKRECEQLQKELSSANRKISQMNSVGHELETSSENEGLRKKQVKLDDQLMEMRRSSSSG
MLSQPLHPRELPQQGCAVVPREQFLQLQQQLLQAEQRGQRLQEELESRPSETNVQQALLP
EQRAVHADSYRRIGHL
Download sequence
Identical sequences G1NLX3
ENSMGAP00000014541 ENSMGAP00000014541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]