SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014571 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014571
Domain Number 1 Region: 497-565,611-671
Classification Level Classification E-value
Superfamily EF-hand 1.3e-23
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 2 Region: 136-199,238-308
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000157
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 3 Region: 341-412
Classification Level Classification E-value
Superfamily EF-hand 0.000000122
Family EF-hand modules in multidomain proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014571   Gene: ENSMGAG00000013788   Transcript: ENSMGAT00000015508
Sequence length 673
Comment pep:novel chromosome:UMD2:1:119390941:119426958:-1 gene:ENSMGAG00000013788 transcript:ENSMGAT00000015508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITDAELACDQAHYYLVIKARTRWHDLARNVQEFDSERNGTIQREHEKSLVQIGIAITPE
EFKKLWARYDNEAMSYHTEQEFLQKLGMGYSPCIKYPILFLIFSNFWHLCLPLGMDSHLN
HLQYAKERDKFRNYFQDFKKAFHKMDKNNDGYVTACDPQRFLQEFNYHPDHDQFSSLLNS
LAISIHDSKLSYFDFLRAIDDGRASKYQQRQKQATPPASFAALSLEQTLIKIKEIVASSC
DLLYKAFSLVDKGDTRVIKTLEFQQVPDRFCFKLSHKQFRNLLKNLNLLLTLILHSKNFI
QNFISYSSRTLSTSHFNLPKNKLPPHLSPEDTCCEGILLCIEKTLLPRYFTYLGDFKDID
SSKDNTISKEVFWNICNQHFQHLTEEQFERTSDKIPLCPQGELKYQEFSKKFSSEQVTMS
STTPSATSPETSTKPVTCASSQPEHPKTSSSLVGQESVSMVVTSASSHPQTTTECSAPVP
NWEEIENKIRKNIQCSWRDILKLCQEKDVSKIGEIPVSDFPDIAEKFHLDLSKEEISQIT
TKYDIKKNGKFAYYDFFQSCILLLKPQKSTLLQRVIIPKPQKPMSPGPQSMLFYSTMLRI
QPQILHCWRPMKRTFKSYDESRTGLLNVADFRQVLHEYKINLSEEELFNILEYYDKTLSS
KISYNDFLRAFLQ
Download sequence
Identical sequences G1NLZ5
ENSMGAP00000014571 ENSMGAP00000014571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]