SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014820 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014820
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 4.14e-57
Family Calmodulin-like 0.0000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014820   Gene: ENSMGAG00000014010   Transcript: ENSMGAT00000015760
Sequence length 193
Comment pep:novel chromosome:UMD2:2:101593940:101632048:1 gene:ENSMGAG00000014010 transcript:ENSMGAT00000015760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVEEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRGE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIV
RLLQCDPSSASQF
Download sequence
Identical sequences A0A087QUX0 A0A087VKE5 A0A091FVR0 A0A091GMA7 A0A091H461 A0A091HI00 A0A091JAJ9 A0A091K401 A0A091KUC8 A0A091LIS6 A0A091LQS1 A0A091NTY3 A0A091QCP3 A0A091QRY6 A0A091R457 A0A091SZC8 A0A091T8X0 A0A091THQ8 A0A091UAM5 A0A091V4G2 A0A091WLM9 A0A093CR46 A0A093ET62 A0A093FZQ2 A0A093GNS3 A0A093JFZ4 A0A093KNE6 A0A093QIX3 A0A093QP50 A0A093RQF7 A0A094MTA1 A0A099ZDZ4 A0A0A0B115 A0A1V4JMY7 A0A218VB95 A0A226MC82 A0A226N650 A0A2I0MTK0 B5FZ84 D8KW81 G1NMK6 K7FA14 P42324 R0K6G4 U3JVY7
ENSMGAP00000014820 ENSTGUP00000013431 59729.ENSTGUP00000013431 9031.ENSGALP00000036116 ENSTGUP00000013431 ENSFALP00000006941 ENSGALP00000026475 ENSPSIP00000004874 ENSGALP00000036116 ENSPSIP00000004874 NP_001157825.1.42559 NP_990565.1.86415 XP_003204542.1.16129 XP_005014164.1.99704 XP_005014165.1.99704 XP_005014166.1.99704 XP_005014168.1.99704 XP_005044325.1.66865 XP_005044326.1.66865 XP_005153304.1.78019 XP_005238218.1.75256 XP_005309707.1.60341 XP_005432296.1.10750 XP_005487258.1.73095 XP_005506887.1.63277 XP_005506888.1.63277 XP_005506889.1.63277 XP_005506890.1.63277 XP_006130830.1.96668 XP_007053236.1.26238 XP_008493383.1.100939 XP_008639995.1.15636 XP_008930947.1.51550 XP_008930947.1.96775 XP_008947412.1.37566 XP_009093440.1.15306 XP_009273858.1.47732 XP_009330765.1.49731 XP_009463721.1.38621 XP_009487025.1.14425 XP_009513165.1.22320 XP_009557937.1.62272 XP_009586070.1.87690 XP_009638102.1.23211 XP_009666064.1.43253 XP_009666145.1.43253 XP_009694634.1.71050 XP_009812725.1.37116 XP_009870294.1.31609 XP_009891561.1.48241 XP_009927683.1.2804 XP_009940355.1.35112 XP_009950202.1.99599 XP_009972165.1.75343 XP_009997450.1.85724 XP_010018445.1.70042 XP_010081161.1.40768 XP_010121166.1.88979 XP_010134190.1.100080 XP_010155932.1.22856 XP_010165822.1.30499 XP_010181635.1.17318 XP_010198566.1.23224 XP_010216844.1.20684 XP_010285356.1.48707 XP_010305220.1.13389 XP_010564981.1.12557 XP_010564982.1.12557 XP_010706220.1.16129 XP_011575238.1.59079 XP_012428220.1.42559 XP_012428221.1.42559 XP_012428222.1.42559 XP_012428223.1.42559 XP_013028070.1.65836 XP_013028071.1.65836 XP_013028072.1.65836 XP_013028073.1.65836 XP_013810540.1.3284 XP_013810541.1.3284 XP_014106962.1.90289 XP_014106963.1.90289 XP_014750472.1.99236 XP_014812373.1.91963 XP_014812375.1.91963 XP_014812376.1.91963 XP_014812377.1.91963 XP_014812378.1.91963 XP_015131510.1.86415 XP_015131512.1.86415 XP_015131513.1.86415 XP_015131514.1.86415 XP_015478328.1.82291 XP_015478329.1.82291 XP_015478330.1.82291 XP_015714931.1.68032 XP_015714933.1.68032 XP_017600535.1.15636 XP_017673633.1.3805 XP_017673634.1.3805 XP_018776300.1.15306 XP_019137768.1.2935 XP_019137769.1.2935 XP_021245669.1.32913 XP_021245670.1.32913 XP_021245671.1.32913 XP_021245672.1.32913 XP_021245673.1.32913 XP_021245675.1.32913 XP_021381090.1.53032 XP_021381091.1.53032 XP_021381092.1.53032 XP_021381093.1.53032 ENSMGAP00000014820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]