SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014876 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014876
Domain Number 1 Region: 1186-1408
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-63
Family DBL homology domain (DH-domain) 0.000000021
Further Details:      
 
Domain Number 2 Region: 1408-1548
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-30
Family Pleckstrin-homology domain (PH domain) 0.000000804
Further Details:      
 
Domain Number 3 Region: 1097-1184
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-28
Family SH3-domain 0.0000074
Further Details:      
 
Domain Number 4 Region: 230-333
Classification Level Classification E-value
Superfamily EF-hand 1.46e-27
Family Eps15 homology domain (EH domain) 0.0026
Further Details:      
 
Domain Number 5 Region: 1562-1682
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-27
Family PLC-like (P variant) 0.0042
Further Details:      
 
Domain Number 6 Region: 12-106
Classification Level Classification E-value
Superfamily EF-hand 1.06e-25
Family Eps15 homology domain (EH domain) 0.0015
Further Details:      
 
Domain Number 7 Region: 755-824
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-21
Family SH3-domain 0.0000345
Further Details:      
 
Domain Number 8 Region: 976-1035
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-19
Family SH3-domain 0.000051
Further Details:      
 
Domain Number 9 Region: 869-955
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-18
Family SH3-domain 0.0000227
Further Details:      
 
Domain Number 10 Region: 1047-1117
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000121
Family SH3-domain 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014876   Gene: ENSMGAG00000014061   Transcript: ENSMGAT00000015817
Sequence length 1692
Comment pep:novel chromosome:UMD2:2:109706761:109751378:-1 gene:ENSMGAG00000014061 transcript:ENSMGAT00000015817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSLSFCVVVSGGPNIWAITAEERAKHDKQFDSLKPTGGYITGDQARTFFLQSGLPSSVLA
DIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQHLPMVLPPVMKQTPVLSPLMSARFGMG
SMPNLSMPTSMSTITPLAPMSLTSMTSIPPLVISAPLVPSVSTSSLPNGTSSLLQPLAIP
LSSISVQPHTGSLGPVAGGFGGSNMQKAQSLIDLGSSSSNSSSSASLAGNSPKIAPSDWA
VPQASRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWSLADIDGDGQLKA
DEFVLAMHLTDMAKAGQPLPLTLPLELVPPSFRSGKYSENMNGTLPSYQPVQEEEPQKKQ
PVTFEDKRKANYERGNVELEKRRQVLLEQQQREAERKAQKEREEQERRERERQEQERKKQ
LEMERQLERQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQRNREQE
EIIKLTSKKKSLNLELEALTDKHQQISGRLQDIRSKKQIRRTELEALDRKCDQGIMEVKQ
LQQQLQEYQNKLTYLVPEKQLLSERIKNVQLDSTQNAGIASVQKKSLEKEELCQRLKEQL
DALEKETASKLAEMDAFNSQLKCDSMDDSVLQCLLSLLSCLNNLFLLLKDLRESYSTQQL
ALEQLHKIKQSKIREVEKRRAELAQKKRLEDEAARKAKREKENRWQENIRREEEEKKKRL
EEERMQEKVQEKLHEEEEKNKQDGNTISASESRNSVAFVNYRALYPFEARNHDEMSFNTG
DIIQVDEKNVGEPGWLYGSFQGRIGWFPCNYVERIPEGEKALSPKKALLPPTVSLSTTSA
TSEPLSPSKSVEESDYQNVHFSSLNVNAAWQQKSAFTRTVSPGSVSPIHGQGQPVENLKA
QALCSWTAKKDNHLNFSKNDIISVLEQQENWWFGEVHGGRGWFPKSYVKLLPGIEKKEEP
EAIYAAVKKKSSAQLYPAGEEYVALYSYSSSEPGDLTFTEGEEILVTQKEGEWWTGSIDD
RTGIFPSNYVRPKDQEGSGNAGKTGTINKKPEIAQVTTAYAASGSEQLSLAPGQLILILK
KNASGWWQGELQARGKKRQKGWFPASHVKLLGPSSERTTSAAPSVCQVIAMYDYMANNED
ELSFSKGQLINVLSKDDADWWQGELNGVTGLFPSNYVKMTTDSDPSQQWCADLQSLDTMQ
PMERKRQGYIHELIQTEERYMDDLQLVLEVFQKPMADSGCLTEGEMGLIFVNWKELIMSN
TKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGASLLQQKTDEEAD
FKDYLKKLALDPRCKGMPLSSFLLKPMQRITRYPLLIKSILENTPENHPDHSNLKLALER
AEELCSQVNEGVREKENSDRLEWIQSHVQCEGLAEQPIFNSLTNCLGPRKLLHSGKLYKA
KSSKELYGFLFNDFLLLTYMVKQFVSSGSDKLFSPKSNSQFKMYKMPVFLNEVLVKLPTD
PSSDEPVFHISHIDRVYTLKTDNINERTAWVQKIKAASEQYIETEKKKREKAYQARSQKT
SGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTMQDTLNPKWNFNCQFFIK
DLYQDVLCITMFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPTTKHLLLHEVPTGEVWVR
FDLQLFDQKTLL
Download sequence
Identical sequences G1NMQ1
ENSMGAP00000014876 ENSMGAP00000014876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]