SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015047 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015047
Domain Number 1 Region: 550-640
Classification Level Classification E-value
Superfamily EF-hand 0.000000000265
Family Calmodulin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015047   Gene: ENSMGAG00000014226   Transcript: ENSMGAT00000015995
Sequence length 642
Comment pep:novel chromosome:UMD2:2:113379922:113397890:-1 gene:ENSMGAG00000014226 transcript:ENSMGAT00000015995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEPRPGLPFLPGCSFREPMKTSFHRSQTLGYKNGFAFSRLPTVGIGGERLYVNQPSQA
ELDELSNTGPTLTYGRAKKAPPSGFIPTHVAFDKKVLKFDAYFQEDVPLSTEEHSRIRQV
GIYYYLEDDTISVIEPVVKNSGIPQGKLIRRHRVPKNDQGDHYHWKDLNRGINITMYGRT
YRIVDCDPFTQVFLESQGIELNPPEKMVFDPYTELRRMPMRMYITPSDFDQLKQFLTYDK
QVLRFYAMWDDTNSMFGENRPYVIHYYLADDTVEVREVHKPNDGRDPFPVLIKRQRLPKT
FVDKKKTFPSCVLEISDQEVLEWYTAKDFAVGKPTTLLGRTFFIYDCDEFTRNFYCDKFG
ITDFQPVEIKKKPPEEVPQVIPPYNGYGFLEDSLQNCYSLFPKPPRKDVIKMLENDHKVL
RYKVALESPNPVDAKRRFILSYFLSNDMISIYEPPVRNSGIIGGKYLGKTRVAKPGSSTE
NAVYYGPADLTIGSTIEVFGHRFVITDADEYVLNYMESNAESFPATTLQSMRDHFHPRQV
VEETAKSDVPAPGTSKQELDELIARVQEELKLHNYLNYSNIREALLRCDKDESGFLNKAK
FLSVCDSLKVPTSAVLVNKLIDLCCCGDDKINYRDFLRAFPS
Download sequence
Identical sequences G1NN46
ENSMGAP00000015047 ENSMGAP00000015047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]