SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015107 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015107
Domain Number 1 Region: 34-98
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 227-269
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000251
Family VWC domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000015107
Domain Number - Region: 196-222
Classification Level Classification E-value
Superfamily EF-hand 0.000123
Family Calbindin D9K 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015107   Gene: ENSMGAG00000014283   Transcript: ENSMGAT00000016056
Sequence length 307
Comment pep:novel chromosome:UMD2:1:83592621:83605178:1 gene:ENSMGAG00000014283 transcript:ENSMGAT00000016056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLFLLAVLLLMFAPVLLVLQEEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKAEKKSENPAASPVVCYQSDRD
ELRRRVIQWLEAEIIPDGWFSKGSNYSEVLDKYFKKVILHVNSPVSFEIYLKQNSRLGAS
RRYPKHASVFPFRGLCIDALIELSDENADWKLSFNEFLKCLSPSFNPPEKKCALEDETYE
DGAETQVECNRCVCACGNWVCTAMTCEAHRQQPGQDLTEEELARYVQELQKHQETAEKTK
KMSTKEM
Download sequence
Identical sequences G1NN97
ENSMGAP00000015107 ENSMGAP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]