SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015217 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015217
Domain Number 1 Region: 199-285
Classification Level Classification E-value
Superfamily SH2 domain 3.47e-47
Family SH2 domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 7.72e-47
Family N-terminal domain of cbl (N-cbl) 0.00000432
Further Details:      
 
Domain Number 3 Region: 292-369
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 114-198
Classification Level Classification E-value
Superfamily EF-hand 1.18e-36
Family EF-hand modules in multidomain proteins 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015217   Gene: ENSMGAG00000014382   Transcript: ENSMGAT00000016166
Sequence length 628
Comment pep:novel chromosome:UMD2:1:90812166:90906473:-1 gene:ENSMGAG00000014382 transcript:ENSMGAT00000016166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLCQNPKLQLKNPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKK
SKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKAD
AADFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISIFEFDIFT
RLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAI
GYVTGDGNILQTIPHNKPLFQALIDGSREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQ
EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKG
TEPIIVDPFDPRDENSRCCSIIDSFSMPMLDLDDDDDREESLMMNRLASVRKCNERQNSP
VTSPGSSPLAQRRKPLPDPLQIPHLSLPPVPPRLDLIQKGVARSPCASPTGSPKSSPCMM
RKQDKPLPAPPPPLRDPPPPPPERPPPIPPDNRISRHLHHPESVPSRDQPMPLEGWCPRD
VFGTSQLVGSRTGSDTSPKPGLTAVSNMNGRHNRISSEQGFMRKHRRHELPVEGAKVFSN
GHLINEEYDVPPRLSPPLPAASTIPSIK
Download sequence
Identical sequences G1NNJ1
ENSMGAP00000015217 ENSMGAP00000015217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]