SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015388 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015388
Domain Number 1 Region: 208-307
Classification Level Classification E-value
Superfamily EF-hand 2.42e-30
Family Eps15 homology domain (EH domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 9-105
Classification Level Classification E-value
Superfamily EF-hand 7.34e-25
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 913-975
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 4 Region: 997-1073
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-18
Family SH3-domain 0.0000746
Further Details:      
 
Domain Number 5 Region: 740-832
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015388   Gene: ENSMGAG00000014532   Transcript: ENSMGAT00000016343
Sequence length 1094
Comment pep:novel chromosome:UMD2:1:111263675:111353454:-1 gene:ENSMGAG00000014532 transcript:ENSMGAT00000016343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGNQDIWAITEERAKHDQQFHSLKPTSGFITGDQARNFFFQSGLPQPVLAQI
WALADMNNDGRMDQLEFSIAMKLIKLKLQGYQLPSALPPVMKQPPIALSSAPGFGIGGIA
SMPSLTTVAPVPMASIPVVGMSPPLVSSVPAAAVPPLANGAPAVIQPLPAFAHPATLPKS
SSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTG
PQARTILMQSSLPQAQLATIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPE
YIPPSFRRVRSGSGVSAVSSVSVDQRLPEEPALEEEQQQLEKKLPEIKVTFEDKKRENFE
RGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQREL
ERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNREQEDIVVLKAKKKTLE
FELEALNDKKNQLEGKLQDIRCRLSTQRQEIESTNKSRELRIAEITHLQQQLQNITSLLG
MKLIPQKQLLNDQLKQVQQNSLHRDSLLTIKRALEAKELARQQLRDQLDEVEKETRSKLQ
EIDIFNNQLKELREIHNKQQLQKQKNLEAERLKQKEQERKTELEKQREAQRRIQDRDKQR
LDRVQQEEEPQWQKKNQEDDKQKREEIIKKKESEDKGKQEIQEKPSKLFQPHQEPVKPAV
QTPWSNAGKAPLTISAQEDVKIVYYRALYPFESRSHDEITIQPGDIVMMEVKREWVDESQ
TGEPGWLGGELKGKTGWFPANYAEKIPESEVPASIKPVETASAPKVSVHETTTSLGTAAS
TECTTTANNWADFSSTWPANTNEKAETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATVTG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKATMSGEEIAQVIASYTATGPE
QLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKTTPTELPKS
TALPSGKQCINGVD
Download sequence
Identical sequences G1NNX3
ENSMGAP00000015388 ENSMGAP00000015388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]