SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015686 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015686
Domain Number 1 Region: 486-660
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 2 Region: 638-737
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-16
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Domain Number 3 Region: 806-931
Classification Level Classification E-value
Superfamily EF-hand 0.0000269
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015686   Gene: ENSMGAG00000014801   Transcript: ENSMGAT00000016645
Sequence length 1150
Comment pep:novel chromosome:UMD2:1:140534146:140572072:-1 gene:ENSMGAG00000014801 transcript:ENSMGAT00000016645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFCPSEVVLQRRFKFVVVSWFVCFCYMERLAGFRTGGSMTAGRLVGALDAVLDSNARVA
PFRILLQVPGSQVYSAIACGATAEEINQHWEWLEQNLLHTLSVFDNKEDIVSFVKGKVKA
LIAEETSSKLAEQEEDPEKFREALVKFESRFNFPEAEKLITYYSCCCWKGKVPRQGWLYL
SINHLCFYSFFLGKESMAVKLIIPWVEVQKLERTSNVFMTDTVRVTTPNKERDFSTFLNI
AEAFRIMEQLADVTLRRLLDNEIFELDPGLQDPTQITKRDLEARAQNEFFRAFFRLPRKE
KLHEVVDCSLWTPFSRCHTVGRMYTSDSYICFASKENGSCNVIIPLREEKVISIEKMEDT
SLLPNPIIVSIRSKTAFQFIELKERDALVENLLQRLKAVNSSNPVHCNNLQSKNQNTPVF
TSACVLGGCEPGSPGMEAAQSKDRSECDKESSYLLNAEALRSDFHQSGMAGLDFGKSREQ
IKESLWDDHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGKLWLLFSDAVTDLASHPGYYV
HLVEASMGKCCIVTEEIERDLHRSLPEHPAFQSETGIAALRRVLTAYAHRNPKIGYCQSM
NILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEQLPELAEH
MKDLTTLASISLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAILEANAVDLCN
SKDDGQALMILSRFLEHVKNEESPLPPIGNHHAFFSDDQEATPVTEIANLIHDSYEKFGD
HSVEQIEHMRYKHRIRVLQSHEDTTKQNVLRVVIPDVSILPEDLEELYDLFKREHLIRCY
WDTAGPAAERHDPSRPYAEQYRIDAQQFTNLYKLVSPWTCGEHTDILAERTFRLLDDNMD
HLIEFKGLASCLDVMYNGEMNEKIKFLYKLHIPPALTEDERESQSPLKNPLLSTSRPLVI
GKSNGDAVDYQKQLKQMLKDLAKEKDTKTEKELPKMSQREFIQFCKTLYSMFHEDPEEND
LYQAIATVTTLLLQIGEVGQRSISLGSGSDEFSEDLQAQASVSDHDAVFSDTVKTLHRDS
QSSPVTEGDWTVSFEHILASLLTEQSLVNFFEKPLELKPKLENAKLNQYSLKTNGMSCQS
RSEHTKLNTQ
Download sequence
Identical sequences G1NPL9
ENSMGAP00000015686 ENSMGAP00000015686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]