SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016015 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016015
Domain Number 1 Region: 156-244
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.83e-18
Family Translation initiation factor IF3, C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 79-149
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 2.48e-16
Family Translation initiation factor IF3, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016015   Gene: ENSMGAG00000015101   Transcript: ENSMGAT00000016982
Sequence length 277
Comment pep:novel chromosome:UMD2:1:183763086:183765908:1 gene:ENSMGAG00000015101 transcript:ENSMGAT00000016982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFCVMKLLCQTTRSETRYAKRFCGTLLSQTTQKGVFPPFWMAVPHPRKTNVLVFAQPF
CTAEKSRKDPKKKAAFGSVGRRIPYRILHVINQDGESLGDMHRAEALRLMDEHNLKLVLL
RENAEPPVYRLMTGQQIHEEKLKRAEKEKASLKTVLVQKELSFSSAIAKNDLETKTKQIT
HWIEKKYHVKVTIRQGRDSNTDMHQLIKLFDQILEAMSDKATYLSKPKAIKEGTSMCILR
HMSDKELKAYQKMEKQKNSMVKKDENEEPKSINFYCR
Download sequence
Identical sequences G1NQD1
ENSMGAP00000016015 ENSMGAP00000016015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]