SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016033 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016033
Domain Number 1 Region: 175-324
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000191
Family Calmodulin-like 0.03
Further Details:      
 
Domain Number 2 Region: 58-199
Classification Level Classification E-value
Superfamily EF-hand 0.000000000171
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016033   Gene: ENSMGAG00000015121   Transcript: ENSMGAT00000017002
Sequence length 367
Comment pep:novel chromosome:UMD2:1:186022385:186081612:1 gene:ENSMGAG00000015121 transcript:ENSMGAT00000017002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQKEDVANAEMAERLSLRKNRFMHFASLEYEGEYYMTPRDFLFSVMFDQVERKSSAKKL
TKKEVDAALLCVTKAKPGPTFFRELGDKGLISYAEYLFLLTILTKPQTGFQIAFKMLDTD
GNEQVEKKEFFKMQRIIGKEDDLKTAGDETIFQEAELESCDVNTMLLVHFFGKEGKEKLR
YSEFFRFMENLQTEVQEMEFIQFSKGLNVMRKEDFAEWLLYFTDEENNEIYWQNVKDRFE
AGENISLEEFKTFCKFTNNLEDFSIAMQMFTVANRPVKRAEFKRAVKVATGQELSDNILD
TIFKIFDLDGDDCLSHGEFLGVLKKRIHRGLRQVPQQQGIQGYWKCVKRESIKGAKELWK
QSGKSPF
Download sequence
Identical sequences G1NQE9
ENSMGAP00000016033 ENSMGAP00000016033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]