SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017212 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017212
Domain Number 1 Region: 8-98
Classification Level Classification E-value
Superfamily EF-hand 1.52e-17
Family S100 proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017212   Gene: ENSMGAG00000016355   Transcript: ENSMGAT00000018272
Sequence length 108
Comment pep:known scaffold:UMD2:GL424679.1:1112:2946:-1 gene:ENSMGAG00000016355 transcript:ENSMGAT00000018272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADKGNCTLEKALESIVNIFHQYSIREGQLDLLNFNDFQTMLTEQAPNFLKGRSRPGYLQ
KLFEETDLNKDKELTFEEFTIVLAKVTDDAHRIIHKDDRCRSSHHHRP
Download sequence
Identical sequences H9H249
ENSMGAP00000017212 ENSMGAP00000017212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]